Main
Components
List
Summary
Search

SerogroupO59 
SerotypeO59:H19 
Strain 
ECODAB#103

Structure
Unknown 
CarbBank
LinucsID
Non-sugar components 
Comments[1] contains genetic information but no structure. 

Identical to 
Cross-reacts with 

1H-NMR
 
ConditionsSolvent: not stated; Temp.:
Referencenot stated=ppm
Comment

13C-NMR
 
ConditionsSolvent: not stated; Temp.:
Referencenot stated=ppm
Comment

wzx (flippase)
TrEMBL entry Q4KZ30
Sequence

MSNYIKNAGWIFFEKFVRIAISFMLFAFVSRVLNPNDFGVLSYYQTITTMLLALTNLGFD NVLINEFNQNEKHNKIFATAFWSRIIVSTVVILLFAVGVCFYDLPMVNKIVLLLCLSSLV FQTQNTYVSYFQSQLQASIITKISFLSLLLSALVKVYLLMTDKNIIWFAFSYSFDFAVSF LFFAVFSYKRNYVSISLRYFDLNVLKGLLRSSWPIIASAVIVVLYTRLDQLMIMNMLGSD SVAIFSVAIKISEAYLFVPAALVTSYYPLISKSPSNDNIRFYFDVVFATSIIMAVGVAII SFFLIPIMFGEYYACSYTILIVLLLGSLFSILGSACTNLMIVYGLSYLRLIRAIFGLLVN FSLNLIFIPKYGVIGAAYASVVSQIFAAWVSNAFSKKTIECFKLQTITVLTCGVLGGRQL CQILFKK



wzy (polymerase)
TrEMBL entry Q4KZ36
Sequence

MKKSEFQAEKLIILFYFIINLCTFIIITSSSIYIGDPAGEYYTVPLDIAIILFISNTAIY YLLYLIYRCCVSHIAFHNEVIIKRIETLLFLGVTIALLGFFWIDYGRAEYQSTSPFGFVF RLIPYSVIWLLYVSINSKWNAKSIFLIVYYVAAKIIMGWSGILLALFWVLFIKYYSAKKR SFLFMCMCMTLLVILYFSAPIVYYLKYYIRYAGQFEFNYPVLLSKLTARLSTIQNVLYIY QNTNVFTNLYNKYLFDGFYFIEPITSILPRALLGISATNFETIYVNIVTGEFNPGVIFYL GLFGKLLAYFNTGIYNFGNFFIVTFVLLGGLFILLKLNFKKAANPFIFYTIIQFALSGSI EELSYTLYGICLVLIFCKIRFGIHNENRY



CommentData from [1]

GT name Position in
gene sequence
Linkage number Donor Acceptor Similar to BLAST Comments
WclA 1 3 aDGal(1->
aDGalNAc(1->
aDGlcNAc(1->
->3)aDMan O22 WbhP (ECODAB)
O148 WbbG (ECODAB)
O87 WfgO (ECODAB)
O146 WbwU (ECODAB)
AAV74375 [1] Function is very uncertain.
WclB 2 2 aDMan(1-> ->?)bDMan O9 MtfB (ECODAB)
O141 WfcC (ECODAB)
O9 MtfA (ECODAB)
O7:K1 WbbC (ECODAB)
O8 Orf469 (ECODAB)
AAV74377 [1]
WclC 3 1 bDMan(1-> ->3)aDGlcNAc O6 Orf7 (ECODAB)
O73 WbaD (ECODAB)
O77 WbaD (ECODAB)
O106 WbaD (ECODAB)
AAV74378 [1]

References [1] FEMS Microbiol. Lett. 248 (2005) 153-161 [PubMed 15990253]
Edit this entry
 
Wed Apr 16 15:05:26 CEST 2014