Main
Components
List
Summary
Search

SerogroupO148 
Serotype 
Strain 
ECODAB#113

Structure

->3)aLRha(1->3)aLRha(1->2)aDGlc(1->3)aDGlcNAc(1-> 
CarbBank
LinucsID
Non-sugar components 
CommentsStructure [1] 

Identical toclosely related to Shigella dysenteria 1 . E.coli O148 has D-Glc in place of D-Gal [1, 2] 
Cross-reacts with 

1H-NMR
5.09 4.22 3.92 3.55 3.87 1.33
5.08  4.15 3.86 3.55 3.87 1.29
5.53 3.64 3.75 3.48 3.63 3.81
5.02 4.12 4.04 3.78 4.04 3.81
 
ConditionsSolvent: D2O; Temp.: 27C
Referenceacetone=2.225ppm
Comment[1]

13C-NMR
103.4 68.2 76.4 71.8 70.8 18.3
102.8 71.1 79.5 72.7 70.8 18.1
99.2 78.0 73.8 70.6 73.7 61.7
95.6 53.4 77.1 72.5 73.2 61.7
 
ConditionsSolvent: D2O; Temp.: 27C
Referenceacetone=31.45ppm
Comment[1]

wzx (flippase)
TrEMBL entry Q0H8D2
Sequence

MKKNILLLFLVHGANYLFPFIVLPYQTRILSIETFADVAKIQAAVMLLSLIVNYGYNLSSTRAIARAVSQ AEINKIYSETLIVKLLLATICLALGYVYLMYVKEYSLIYPFIISSIYLYGSALFATWLFQGLEKMKAIVI ATTIAKLTGVILTFILVKSPNDIDAALFTQNIGMFISGIISIYLVRKNKYATVIYFRLKNIILSLKEAWP FFLSLAATSAYTYFNVILLSFYAGDYVVANFNAADKLRMAAQGLLIPIGQAVFPRLSKLEGYEYSSKLKI YAIRYAIFGVCISAGLVFLGPMLTTIYLGKEYSLSGEYLQSMFLLPAIISISTILSQWMLIPQGKEKILS RIYILGAIFHLLYAFPLVYYYGAWGMVISILFTEVLIVLFMLKAVK



wzy (polymerase)
TrEMBL entry Q0H8D1
Sequence

MTYFTGFILILFAIIIKRLTPSQSKKNIVLIANAFWGILLVGYAFNEQYFVPLSATTLFFILAFLFFFSM TYILIARSGRVVFSFGTGFIESKYIYWFAGMINIISICFGIILLYNNHFSLKVMREGILDGSVSGFGLGI SLPLSFCCMYLARHENKKNYFYCFTLFSFLLAVLSTSKIFLILFLVYIVGINSYVSKKKLLIYGTFVFGL FALSSIILGKFSSDPEGKIISAIFDTLRVYLFSGLAAFNLYVEKNVTLPENLLLYPFKEVWGTTKDIPKT DILPWINTGVWDTNVYTAFAPWYQSLGLYAAIIIGILLGFYYGIWFSFRQNLAVGFYQTFLCFPLLMLFF QEHYLLSWKMHFIYFLCAILLAMRKALEYE



Comment[1]

GT name Position in
gene sequence
Linkage number Donor Acceptor Similar to BLAST Comments
WbbR 1 3/2 aLRha(1-> ->3)aLRha
->2)aDGlc
O146 WbwV (ECODAB)
O13 RfbF (ECODAB)
O135 RfbF (ECODAB)
O147 WfbY (ECODAB)
O150 WfgI (ECODAB)
ABA42233 [1]
WbbQ 2 2/3 aLRha(1-> ->2)aDGlc
->3)aLRha
O150 WfgI (ECODAB)
O135 RfbF (ECODAB)
O13 RfbF (ECODAB)
O146 WbwV (ECODAB)
O147 WfbY (ECODAB)
O2 WbbQ (ECODAB)
O177 WbdY (ECODAB)
O139 WfaI (ECODAB)
ABA42234 [1]
WbbG 3 1 aDGlc(1-> ->3)aDGlcNAc O128 WbsH (ECODAB)
O113 WbnE (ECODAB)
O3 WclR (ECODAB)
O55:H7 WbgM (ECODAB)
O40 WffO (ECODAB)
O22 WbhP (ECODAB)
O87 WfgO (ECODAB)
O141 WfcD (ECODAB)
ABA42235 [1]

References [1] Microbiology. (2007) 139-147 [PubMed 17185542]
[2]FEMS Microbiol Rev. 32 (2008)627-653. [PubMed 18422615]
Edit this entry
 
Fri Oct 24 10:28:42 CEST 2014