Main
Components
List
Summary
Search

SerogroupO86 
SerotypeO86:K62:H2 
Strain 
ECODAB#139

Structure
         aDGal(1->3)
                  |
->4)aLFuc(1->2)bDGal(1->3)aDGalNAc(1->3)bDGalNAc(1->  
CarbBank
LinucsID
Non-sugar components 
Comments 

Identical to 
Cross-reacts with 

1H-NMR
5.22 3.89 3.89 3.98 4.20 3.73
4.68 3.89 3.95 4.27 3.65 3.78
5.04 4.23 3.94 4.21 3.86 3.76
4.56 4.14 3.78 4.06 3.66 3.78
5.22 3.78 3.54 3.78 4.33 1.21
 
ConditionsSolvent: D2O; Temp.: 70C
Referenceacetone=2.212ppm
Comment1H-NMR [1]

13C-NMR
94.3 69.0 70.4 70.3 72.0 62.2
103.2 73.9 75.5 64.7 75.3 61.8
94.1 49.6 77.4 69.8 71.8 61.7
103.6 51.9 75.6 64.5 76.0 61.8
99.7 69.3 70.3 83.4 67.8 16.2
 
ConditionsSolvent: D2O; Temp.: 70C
Referencedioxan=67.4ppm
Comment13C-NMR [1]

wzx (flippase)
TrEMBL entry Q4KXD2
Sequence

MIKLLFSSSLLKMGVVLLNLLIPAIIIRFYSEYDFGIYSYLLTYAIVISVLQNGITASFRNLISNLEKND LLDYLLYSVRKITYPFLLIIFCLLLATLYVVGFDTLYGKICFFIAVSLINLYYPVVASYYDATGKTLNFV LLEIIFLLVFIAGVGILIYYKVSIYIVCILTANYRGVYAILLIMKKCVIFKQIRLKKKGGYKIFCSDDMI FIIIQLINVSNTLLFMNMFAKFYGVVAFGVFSVYYRFVAFPQQVISFSSSLIWINFRQVHVNNRVAAMQL LKRLFFIFTLLLIIWGGCVHFFIDKVVYLYSSKPLEYPGVLCFLNIMVCLMLLKDFSSIILNALTLYKEQ MIMNALLCLLNVIFFFFYNETNFDTIYLIFVSLLTLMFVFVNLSLIRSRL



wzy (polymerase)
TrEMBL entry Q4KXD0
Sequence

MVKIKTPRLLCVIRKEKVGMVISRSNYRNICSYTFFMVNLFILILSVINEGFCEIAYVIISVSSVLFCVI IICLERQGGFLNPMTFCIISVFFFILIRPVFFSQNITENLNEVITAGLEIDEIYVFYSLAVVNISLAFTV LLYSVQKGTVSKLVGQLPDLFFYNKQLSMILLWGGGLFSAIFLIKSYKKFIILGQVSVFEADAYGLHDEL FWFTLSKYCYILSLLFSKNKNFILYSLLIFITSIGYILVGLRGYTIAYGFLLLFFLDIRYRLKIKWLLLV AILVTTISSLILNYRIGIEVNSGLLGIIFNPLLQQGASFETVYGALKYNEKILSCISYYDYFFTNKDIGS CIDIARGVYFKEGGSFASSFYSELIYLGWIIGSVALLLFAFSLAFVQSCYEKIIKNSMNNKLAYTYRLII FLALPNLIYFARSSLFDFITKVLFIALFIGGLSIVRHIALNIKKCH



CommentFrom [2]

GT name Position in
gene sequence
Linkage number Donor Acceptor Similar to BLAST Comments
WbnH 1 1 aDGalNAc(1-> ->3)bDGalNAc O87 WfgO (ECODAB)
O22 WbhP (ECODAB)
O55:H7 WbgM (ECODAB)
AAV80749 [2]
WbnI 2 3/4 aDGal(1-> ->3)bDGal O86:K2:H2 WcmB (ECODAB)
AAV80756 [2]
WbnJ 3 2 bDGal(1-> ->3)aDGalNAc O86:K2:H2 WcmC (ECODAB)
O167 WfdH (ECODAB)
O128 WbsK (ECODAB)
O113 WbnA (ECODAB)
O86:B7 WbwJ (ECODAB)
AAV80758 [2]
WbnK 4 3/4 aLFuc(1-> ->2)bDGal O86:B7 WbwK (ECODAB)
O126 WbgL (ECODAB)
O55:H7 WbgN(ECODAB)
O55:H6 WbgN (ECODAB)
AAV80759 [2]

References [1] Carbohydr. Res. 185 (1989) 211-223 [PubMed 2471591]
[2] J Am Chem Soc.127(7),(2005) 2040-2041 [PubMed 15713070]
Edit this entry
 
Mon Sep 22 18:13:59 CEST 2014