Main
Components
List
Summary
Search

SerogroupO147 
SerotypeO147:K89,K88a,c:H19 
Strain 
ECODAB#22

Structure
->2)aLRha(1->2)aLRha(1->4)bDGalA(1->3)bDGalNAc(1-> 
CarbBank
LinucsID
Non-sugar components 
CommentsStructure [1] 

Identical to 
Cross-reacts withShigella flexneri serotype 6, has additional OAc on Rha [1] 

1H-NMR
5.32 4.07 3.86 3.39 3.63 1.23
5.15 4.11 3.82 3.35 3.66 1.24
4.70 4.01 3.88 4.22 3.66 3.77 3.77
4.49 3.61 3.80 4.33 4.27
 
ConditionsSolvent: D2O; Temp.: 60C
ReferenceTSP=0.00ppm
Comment1H-NMR [1], pD=3.5

13C-NMR
100.6 79.3 70.7 73.0 69.9 17.5
101.7 79.7 70.7 73.3 69.9 17.5
103.6 52.5 81.0 68.5 75.5 61.8
105.1 71.0 73.9 77.0 74.4 173.0
 
ConditionsSolvent: D2O; Temp.: 60C
Referencedioxan=67.40ppm
Comment13C-NMR [1], pD=3.5

wzx (flippase)
TrEMBL entry A6MF10
Sequence

MSIVKNTLWNISGYIIPSLIAIPALGILSRILGAEQFGLFTLAIALVGYASIFDAGLTRAVIREVSIYKN VHKELRSIISTSTVILTILGLIGGSVLFLSSNVIVKLLNINANHVVESVKAIYIISATIPLYLLNQVWLG IFEGMEKFRKVNLIKSINNSFVAGLPVIFCFFHGGLLSAIYGLVMARVLSLIVTFIFSRKLIISSGLSVK IVTVKRLIGFGSWITVSNIISPIMTYMDRFILSHIVGADKVSFYTAPSEGIQRLTILPSALSRAIFPRLS SELQSVKQTKILSYFIMVIGILPIVILIIILSDFIMSAWMGPTYHGTPGIVLKILAIGFFFNCIAQIPFV SVQASGRSKITAIIHLLEVIPYLCILYIFIYHWGIVGAAIAWSVRTSLDFLILLLIDK



wzy (polymerase)
TrEMBL entry A6MF11
Sequence

MTSDFYNSKDKSLSVLLFFGFIFFLTRSFPFIQYSWIMGGFLCLCIMSFTKKIANGIYHYPVILIFLLAL FINFIYSYIKGNDIAIIIRFYIIILFILCAYFCSYGTISIVKIFLYLMVLQAVIISIISIYMTKTYGIGD YSALRHYFLENDYGDVYTYGSGFYRVQIKGNALIPFAFMLHIVIKDYFYYRFKNTITVILAIGTIVAGNF AYFVSICLFFMYIILCSKSNSRYAKLRKIIFGVFLTVILPFFITYSIELIIMKSNGADSSLGVRWDQFTV LINDLTESVSNFVIGSGLGNVIKIQTPIRDYSAYIYYELQSVYFLNQLGVILFTLFLLINLLLTIKIIKY SELCVLYFLYVSYAITNPYILDSNHVAVIIVLVTLSNVLKKMKAK



CommentFrom [2]

GT name Position in
gene sequence
Linkage number Donor Acceptor Similar to BLAST Comments
WfbY 1 2, 3 aLRha(1-> ->2)aLRha
->4)bDGalA
O146 WbwV (ECODAB)
O13 RfbF (ECODAB)
O135 RfbF (ECODAB)
O150 WfgI (ECODAB)
O177 WbdY (ECODAB)
O2 WbbQ (ECODAB)
O148 WbbR (ECODAB)
O139 WfaI (ECODAB)
ABI98987 [2]
WfbZ 2 1 bDGalA(1-> ->3)bDGalNAc O117 WbeD (ECODAB)
O107 WclZ (ECODAB)
O104 WbwC (ECODAB)
O174 WbcZ (ECODAB)
O146 WbwW (ECODAB)
O112ac WfeJ (ECODAB)
O155 WclG (ECODAB)
ABI98988 [2]

References [1] Eur. J. Biochem. 239 (1996) 532-538 [PubMed 9492329]
[2] Appl. Environ. Microbiol.(2007) 4082-4088 [PubMed 17449692]
Edit this entry
 
Thu Apr 24 11:37:13 CEST 2014