Main
Components
List
Summary
Search

SerogroupO128 
Serotype 
Strain 
ECODAB#25

Structure
aLFuc(1->2)
         |
  ->6)bDGal(1->3)bDGalNAc(1->4)aDGal(1->3)bDGalNAc(1-> 
CarbBank
LinucsID
Non-sugar components 
CommentsStructure [1] 

Identical to 
Cross-reacts with 

1H-NMR
4.53 3.99 3.90 4.05 3.68 3.8 3.8
5.08 3.68 3.87 4.11 3.82
4.59 4.03 3.81 4.15 3.66 3.8 3.8
4.61 3.65 3.81 3.90 3.77 3.79 3.79
5.24 3.78 3.66 3.73 4.22 1.21
2.045 2.045
 
ConditionsSolvent: D2O; Temp.:
Referenceacetone=2.225ppm
Comment1H-NMR [1]

13C-NMR
104.7 52.8 78.2 69.6 75.9 62.4
96.9 69.6 70.5 78.0 71.9 61.5
102.6 51.9 77.2 65.4 76.1 62.4
103.3 77.3 74.9 70.0 74.2 69.3
100.4 69.5 70.9 73.1 68.0 16.5
23.6 23.8 175.25 175.35
 
ConditionsSolvent: D2O; Temp.:
Referenceacetone=31.45ppm
Comment13C-NMR [1]

wzx (flippase)
TrEMBL entry Q6XQ54
Sequence

MNKKEIIILLIARILQILISLFTMRLMTTILSNEQMGEYYIFLAIYMLASLGIINPIGQY VNRNTYLWWREGVLTQYINRYINFVLCFSLIYVILYGLGECLFKGINTPFWMLFCYLYIV CLSLNQFLLHTLNILNFKIVFAITTLMTSVLSLSGAYLFIEYSIAKQTVSIYYWVAGIII GNFISLCICVVYLRSKNTFQKSILKSINVSIKEVFNFCCPIMITTLFIWFQSSGYRFAVE QMFGLKFLGILAVCFAVSGQIMSVIESLVTQIFQPTLFKHMDNVKNRKQHLDFYINENIA IYASVLFFCTFFMREIFLVLVDNKYLPYFYIGIIALWSEFFRISTNTLSLVFFCEKKMKV GIFPYLIGSLSLAFSIVLFRLLNVNLGILIAFAIGVAQLASFIVCLITVKKISYFKINSI FLMKRIIIVLPSVLIAHCIPKFEMINAIHFIIIFGVGLFYLISLATSFMFIKQPGGVYGS



wzy (polymerase)
TrEMBL entry Q6XQ50
Sequence

MISYGVLFLFSYINAVLQKRVTVTLLFFIMIIVSFFKYNIGFDWGNYHEIYLQQGDGFFF YEPLFSLLIILSNKVALEYKYFISMCSLITLIVYYSGMRCFARDIKELALALTYFVVSYC YFEHFNIIRQTLAIALFFYSWKYIIETNFIMYSLFIFFASMIHAAAVVLLPFYFFLRIDN FKPVYYGIVVLFIIIVVRFDINSILLSSLNLFKNFDFVARYLANSTDLADFASKKSDLGL SKMYPAIIFVFCCFWGGIRLESRRDYVFFNAGFIAITLLLLSYQVDILFRFFSFFETSFV LLYCIIFSGFNKKSKIILHMVNLIVYTVMTFNMLSVMGLIPYESYIF



Commentwzx and wzy from O128:B12:H strain ATCC 12810 [2].

GT name Position in
gene sequence
Linkage number Donor Acceptor Similar to BLAST Comments
WbsH 1 1 aDGal(1-> ->3)bDGalNAc O55:H7 WbgM (ECODAB)
O113 WbnE (ECODAB)
O3 WclR (ECODAB)
O40 WffO (ECODAB)
O148 WbbG (ECODAB)
O87 WfgO (ECODAB)
O22 WbhP (ECODAB)
37788080 [2]
WbsJ 2 4 aLFuc(1-> ->2)bDGal O55:H7 WbgN (ECODAB)
O86:K62:H2 WbnK (ECODAB)
O86:B7 WbwK (ECODAB)
O126 WbgL (ECODAB)
O127 WbiQ (ECODAB)
AAO37698 [2]
WbsK 3 2 bDGalNAc(1-> ->4)aDGal O113 WbnA (ECODAB)
O55:H7 WbgO (ECODAB)
O167 WfdH (ECODAB)
O86:K62:H2 WbnJ (ECODAB)
O86:K2:H2 WcmC (ECODAB)
O86:B7 WbwJ (ECODAB)
O127 WbiP (ECODAB)
O157:H7 WbdN (ECODAB)
O130 WffJ (ECODAB)
AAO37699 [2]
WbsL 4 3 bDGal(1-> ->3)bDGalNAc AAO37700 [2]

References [1] Carbohydr. Res. 277 (1995) 283-290 [PubMed 8556736]
[2] FEBS Lett. 553 (2003) 99-103 [PubMed 14550554]
Edit this entry
 
Wed Apr 16 09:31:44 CEST 2014