Main
Components
List
Summary
Search

SerogroupO143 
SerotypeO143:K-:H- 
Strain 
ECODAB#43

Structure
->2)bDGalA6NHCH(CH2OH)2,3/4Ac(1->3)aDGalNAc(1->4)bDGlcA(1->3)bDGlcNAc(1-> 
CarbBank
LinucsID
Non-sugar componentsacetate, 2-amino-propan-1,3-diol 
CommentsStructure [1]. 0.3 acetates/repeating unit at position 3, 0.5 acetates/repeating unit at position 4 

Identical to 
Cross-reacts withShigella boydii type 8 [2] 

1H-NMR
5.49 4.35 4.04 4.26 4.00 3.73 3.76 2.11
4.90 3.85 3.75 3.51 3.40 3.73 3.92 2.07
4.66 3.77 3.79 4.19 4.25 3.7 3.7 4.05 3.7 3.7
4.50 3.38 3.71 3.81 3.81
 
ConditionsSolvent: not stated; Temp.:
Referencenot stated=ppm
Comment1H-NMR [1]

13C-NMR
97.6 48.9 78.6 69.4 71.0 61.6 23.4 174.6
101.8 55.5 83.5 69.6 76.2 61.8 23.1 175.4
103.4 77.4 74.6 70.1 75.3 170.9 61.3 53.2 61.4
103.6 74.0 77.2 76.1 77.4 175.6
 
ConditionsSolvent: not stated; Temp.:
Referencenot stated=ppm
Comment13C-NMR [1]

wzx (flippase)
TrEMBL entry B5L391
Sequence

MSSFLRSIISVSALKLVDYIVPIIIMPLVLTRFNLEGYGVYSYVLTISTFISFIYDACLNTVGVQQLNKL KGNEIAQQSFVISAIFFKLVFFFVCAMVFIIISETAGKSDYFCVVIFSFGFGMLNSWYYIAKDNFRFIII VSLVVKILAVLFVLYYAFELHMFIFIQAIASALVGLISLIKIKNDNRLGKISFRHIKNYLKNIKHMYIYS GVNALIQPIINSAILASGNASLLGIYNVVMRFVTVSVTFSNSIITVLNKCNSEVFYSVGHKTNYVEVKYR SQLLKLLFYSIVVFICVAAISYVSIYLTKGEISRFFIFLIFSFSLAVIPSILNQYLTQLIHMIHSSKNIV KYVICSNVLSLISIFLFSSLFPYYYIVYAVVLSPIIITICCLWDLKCKNLL



wzy (polymerase)
TrEMBL entry B5L394
Sequence

MKVFFDVFLLFLFVFAFSIPVFFNSGYLIYIFSLIYLITNIRIRTVFFSLISTRIFFIAFLSLACMLFFS CISLVLNGTGDLSIMGVIFNNFAALFSSVIIASHLIQHNNDNVLKLFFLIALLQSFFIILMMFFPSINAY IQSIIRTKEEIEFMSNTYGGIRGLGISGSVAFGLAIIMSLLSFLSIVWFNEEDCNIPFFFKLFFIILLLF ASISAGRTAVLGFVLGGVYSFICSDYKKKFYRALQILIYVSLFLFIFWRFFLNEHVYDILKKYSDYSFQM LYYYLDSGKLSTTSTDALFNMYFPLTEKQIFIGDGYYTVKGWDILSRDRCWIYAVSIIFGCGTIGYFLFF IFYFFDYLCC



CommentFrom [3]

GT name Position in
gene sequence
Linkage number Donor Acceptor Similar to BLAST Comments
WfdR 1 3 bDGalA(1-> ->3)aDGalNAc O167 WfdG (ECODAB)
ACA24759 [3]
WfdT 2 2 aDGalNAc(1-> ->4)bDGlcA O167 WfdH (ECODAB)
O128 WbsK (ECODAB)
O55:H7 WbgO (ECODAB)
O127 WbiP (ECODAB)
O114 WbuP (ECODAB)
O130 WffH (ECODAB)
ACA24762
WfdU 3 O168 WfeW (ECODAB)
O141 WfcC (ECODAB)
ACA24763 [3]
WfdV 4 1 bDGlcA(1-> ->3)bDGlcNAc O112ab WfeI (ECODAB)
O91 WbsA (ECODAB)
O157 WbdN (ECODAB)
O79 WbdX (ECODAB)
O130 WffJ (ECODAB)
O152 WfgD (ECODAB)
O21 WclQ (ECODAB)
O56 WfaP (ECODAB)
ACA24766 [3]

References [1] Carbohydr. Res. 291 (1996) 209-216 [PubMed 8864232]
[2] Methods Microbiol. 14 (1984) 43-112
[3] FEMS Microbiol.(2008) 627-653 [PubMed 18422615]
Edit this entry
 
Thu Jul 24 19:42:35 CEST 2014