Main
Components
List
Summary
Search

SerogroupO113 
SerotypeO113:K75(B19):H21 
Strain 
ECODAB#7

Structure
  ->4)aDGalNAc(1->4)aDGalA(1->3)aDGal(1->3)bDGlcNAc(1->
         |
bDGal(1->3) 
CarbBank
LinucsID
Non-sugar componentsacetate 
CommentsStructure [1]. Position of acetate not determined 

Identical to 
Cross-reacts with 

1H-NMR
5.39 3.94 3.94 4.24 3.91 3.74 3.74
5.27 3.95 4.12 4.45 4.88
4.96 4.22 4.03 4.44 4.39 3.79 3.64
4.96 3.86 3.83 3.68 3.44 3.92 3.74
4.46 3.56 3.65 3.95 3.67 3.78 3.78
 
ConditionsSolvent: D2O; Temp.: 313K
Referenceacetone=2.230ppm
Comment1H-NMR [1], de-O-acetylated

13C-NMR
100.36 67.81 76.51 66.75 71.16 61.29
97.06 68.60 69.06 79.32 71.45 172.49
99.84 49.71 78.15 76.14 70.75 60.65
102.06 55.01 81.16 71.73 75.86 61.68
105.85 71.82 73.77 69.50 75.79 62.06
 
ConditionsSolvent: D2O; Temp.: 313K
Referenceacetone=31.07ppm
Comment13C-NMR [1], de-O-acetylated

wzx (flippase)
TrEMBL entry Q9RP63
Sequence

MEKNSDKLRTGVRWSAIERIITQIAQLGILLILSRILGPKAYGLIGMLTIFIAISQTLVD SGFSSALIRRNKNSQKQYSTIFWFNLIVSLLIYAVIFFMSPHISAFYREKELSDILRVLS LLVIINALSIVHRARLTIMMDFKTQTKISLIAVLGSGVVSVILAKNGWGVWALVVNNLVF ATISTFLYFWFCKWLPDFIFQLKFFKVTAAFSVKLMIASLLNTFFDNIYQLVIGKVFYPT QVGYFTQAKNLTLLPANTYSAIIQRVTYRYFSEIKNDRVRLRQKYEEVMRISAFIFFPLT ISFSIFSNNIIVFLIGKAWEEAAKYISILSWCYVLYPIHAISLNILNVFGRSDLFLKVEI IKKIIITVCLITTYKYGISAICMGMVFYSLLATYINTIHTNRIIKTNFIALIRIISPIAF ISMLSATISFVICKFFDNNIIYIFGIMISLIIYYLIYYFVDRKIVLTIWKVNK



wzy (polymerase)
TrEMBL entry Q9RP61
Sequence

MNTTSVICFIVFLLNPSFGCFLFLLTLFNHEKLSIFFISLFAGILAYNLVPYDTMDLASH YMKFSELHNMSVSDIWSDGVNIFLYLCMKCLNAAGINKEWLPFIATFIGYYILLNALRNN IPAYWCRKEKMICFIIWLLSISFLSLSNGIRSGLSSAFFIYAVICQRNYRHLSFIIYSVL ACMMHSFAIPMVILLFSMPLILKRKMLSQRFFKIAIIMSVSLSFLVDINSLIVFIFNNLS FLPYIDQIYNIYIIGDRWGGGASFDTNTFIARLITQAPFFYCILVLLISKRKDDFFILGA ILVSVSLFLSQFWVVSERYQYVSVLLVTLHLIFNNEYFLLRRKIIILLYFVIQTAVLIWG LYRFRYMILPSLEFIIYPFLFCFYNTVDMNKLIKV



Commentwzx and wzy from O113:H21 strain 98NK2 [2].

GT name Position in
gene sequence
Linkage number Donor Acceptor Similar to BLAST Comments
WbnA 1 4 bDGal(1-> ->3)aDGalNAc O128 WbsK (ECODAB)
O55:H7 WbgO (ECODAB)
O167 WfdH (ECODAB)
O86:K62:H2 WbnJ (ECODAB)
O86:K2:H2 WcmC (ECODAB)
O86:B7 WbwJ (ECODAB)
O21 WclQ (ECODAB)
AAD50485 [2]
WbnB 2 2 aDGalA(1-> ->3)aDGal O55:H7 WbgM (ECODAB)
O3 WclR (ECODAB)
O24 WfaO (ECODAB)
O22 WbhP (ECODAB)
AAD50487 [2]
WbnD 3 3 aDGalNAc(1-> ->4)aDGalA O87 WfgN (ECODAB)
O22 WbhP (ECODAB)
O111 WbdH (ECODAB)
AAD50489 [2]
WbnE 4 1 aDGal(1-> ->3)bDGlcNAc O3 WclR (ECODAB)
O40 WffO (ECODAB)
O128 WbsH (ECODAB)
O55:H7 WbgM (ECODAB)
O87 WfgO (ECODAB)
O22 WbhP (ECODAB)
AAD50490 [2]

References [1] Carbohydr. Res. 267 (1995) 263-269 [PubMed 7534644]
[2] Infect. Immun. 67 (1999) 5930-5937 [PubMed 10531250]
Edit this entry
 
Fri Oct 24 17:23:28 CEST 2014