Main
Components
List
Summary
Search

SerogroupO157 
SerotypeO157:H7 
Strain 
ECODAB#71

Structure
->2)aDRha4NAc(1->3)aLFuc(1->4)bDGlc(1->3)aDGalNAc(1-> 
CarbBank
2491
LinucsID 3257
Non-sugar components 
CommentsStructure from [2]. [1] gave wrong structure which was subsequently revised. Salmonella urbana and S. godesberg have the same backbone substituted with glucose on position 4 of the GalNAc residue [5]. 

Identical toCitrobacter sedlakii NRCC 6070 [1], Citrobacter freundii OCU158 [1] 
Cross-reacts withCitrobacter freundii NRCC 6052 [3], Brucella melitensis [4], B. abortus [4] 

1H-NMR
4.42 3.16 3.42 3.67 3.38 3.75
4.80 3.73 3.69 3.94 3.58 1.03
4.95 4.18 3.92 4.12 4.07 1.00
5.09 3.79 3.9  3.87      3.59
 
ConditionsSolvent: D2O; Temp.: 70C
Referenceacetone=2.225ppm
Comment1H-NMR [1]

13C-NMR
103.4 73.0 73.9 77.8 74.7 59.5
 98.9 66.7 71.4 76.6      16.4
 99.5 66.6 70.8 48.5 68.2 14.7
100.4 52.8 67.8 77.7      60.9
 
ConditionsSolvent: D2O; Temp.: 70C
Referenceacetone=31.07ppm
Comment13C-NMR [1]

wzx (flippase)
TrEMBL entry O85337
Sequence

MIMNKIKKILKFCTLKKYDTSSALGREQERYRIISLSVISSLISKILSLLSLILTVSLTL PYLGQERFGVWMTITSLGAALTFLDLGIGNALTNRIAHSFACGKNLKMSRQISGGLTLLA GLSFVITAICYITSGMIDWQLVIKGINENVYAELQHSIKVFVIIFGLGIYSNGVQKVYMG IQKAYISNIVNAIFILLSIITLVISSKLHAGLPVLIVSTLGIQYISGIYLTINLIIKRLI KFTKVNIHAKREAPYLILNGFFFFILQLGTLATWSGDNFIISITLGVTYVAVFSITQRLF QISTVPLTIYNIPLWAAYADAHARNDTQFIKKTLRTSLKIVGISSFLLAFILVVFGSEVV NIWTEGKIQVPRTFIIAYALWSVIDAFSNTFASFLNGLNIVKQQMLAVVTLILIAIPAKY IIVSHFGLTVMLYCFIFIYIVNYFIWYKCSFKKHIDRQLNIRG



wzy (polymerase)
TrEMBL entry O85335
Sequence

MKSAAKLIFLFLFTLYSLQLYGVIIDDRITNFDTKVLTSIIIIFQIFFVLLFYLTIINER KQQKKFIVNWELKLILVFLFVTIEIAAVVLFLKEGIPIFDDDPGGAKLRIAEGNGLYIRY IKYFGNIVVFALIILYDEHKFKQRTIIFVYFTTIALFGYRSELVLLILQYILITNILSKD NRNPKIKRIIGYFLLVGVVCSLFYLSLGQDGEQNDSYNNMLRIINRLTIEQVEGVPYVVS ESIKNDFFPTPELEKELKAIINRIQGIKHQDLFYGERLHKQVFGDMGANFLSVTTYGAEL LVFFGFLCVFIIPLGIYIPFYLLKRMKKTHSSINCAFYSYIIMILLQYLVAGNASAFFFG PFLSVLIMCTPLILLHDTLKRLSRNENISYNCDL



Commentwzx and wzy are from isolate C664-1992 (Statens Serum Institut, Copenhagen, Denmark) [6]

GT name Position in
gene sequence
Linkage number Donor Acceptor Similar to BLAST Comments
WbdN 1 1 bDGlc(1-> ->3)aDGalNAc O24 WbdN (ECODAB)
O130 WffJ (ECODAB)
O21 WclQ (ECODAB)
O143 WfdV (ECODAB)
O112ab WfeI (ECODAB)
O152 WfgD (ECODAB)
O91 WbsA (ECODAB)
O79 WbdX (ECODAB)
AAC32339 [6]
WbdO 2 O168 WfeV (ECODAB)
O168 WfeY (ECODAB)
O159 WfgS (ECODAB)
O159 WfgP (ECODAB)
AAC32341 [6]
WbdP 3 AAC32344 [6]

References [1] FEMS Immunol. Med. Microbiol. 28 (2000) 163-171 [PubMed 10799808], revised in FEMS Immunol. Med. Microbiol. 32 (2002) 255.
[2] Biochem. Cell Biol. 64 (1986) 21-28 [PubMed 3008786]
[3] FEMS Microbiol. Lett. 190 (2000) 157-161 [PubMed 10981707]
[4] Infect. Immun. 58 (1990) 1391-1395 [PubMed 1691146]
[5] Carbohydr. Res. 156 (1986) 107-122 [PubMed 3815404]
[6] Infect. Immun. 66 (1998) 3545-3551 [PubMed 9673232]
Edit this entry
 
Sat Sep 20 17:58:24 CEST 2014