Main
Components
List
Summary
Search

SerogroupO66 
SerotypeO66:K-:H25 
Strain 
ECODAB#77

Structure
->2)bDGlc3Ac(1->3)aL6dTal(1->3)aDGlcNAc(1->2)bDMan(1->3)aDGlcNAc(1-> 
CarbBank
LinucsID
Non-sugar componentsacetates 
CommentsStructure [1] 

Identical to 
Cross-reacts withEscherichia coli 4610 (O45) and 3332 (O45rel) [1] 

1H-NMR
5.02 3.89 3.87 3.64 4.24 1.21
5.11 3.98 3.88 3.56 4.02 3.82 3.82
4.73 3.92 3.76 3.71 3.40 3.94 3.80
5.43 4.06 3.95 3.56 4.10 3.80 3.80
4.74 3.52 3.59 3.47 3.43 3.77 3.72
 
ConditionsSolvent: D2O; Temp.: 90C
Referenceacetone=2.225ppm
Comment1H-NMR [1]

13C-NMR
102.8 70.9 76.5 71.7 68.9 16.7
99.6 55.0 81.0 69.3 73.1 61.7
101.4 78.1 74.9 68.2 78.1 62.0
97.2 53.9 81.3 69.3 73.1 61.6
104.8 75.7 77.4 67.0 76.8 61.6
23.3 174.7 23.3 174.4 21.45 173.9
 
ConditionsSolvent: D2O; Temp.: 90C
Referenceacetone=31.45ppm
Comment13C-NMR [1]

wzx (flippase)
TrEMBL entry Q1AL85
Sequence

MNYLVNRKDIIWGYLSQFLNISSSLLLLPFILKCLNEEEIGLWYVFVAMAGIIQLLEFGLLPTISRFISY VYSGALNLEYGKIPKCNIGDFNKELLNDVVVTCRCIYFKIALFALVGILILGNAYIYTLSTSINKYYILC CWSVYGLSICIQLYFGYYNAILKGRGDQTLLNKIIVVAKLTLLLISIPLLIAGCGLVSLAVGAVISVIID RILIRKYVYSQESGLIRNLEKSNKTVSLKKVIWQSARDMGVVQLGNYLSVRAGVLIVSSFVNLDAAASYG LTVQVTMVIVIIASMFFGLNIPRITSEQAHENMLVVKNLMKKSLLIANCIYIFAALILVAIGDDILAFLT KNTTLLPKELLILYLVTALFEMNYSICTSYLTTRNEVIFIKSMLYTGVAIVLFSFISTYIAEMGALGVIL SQLLMQSLYNNWHWPLKVYQELKND



wzy (polymerase)
TrEMBL entry Q1AL83
Sequence

MKNKISFYIAYIYIAPIILSLYYISTTNSLLGDFRTYSYKLEWESSLLFLILYFIPLIIIFCVVKMTGKI KVDTFESIKLEKFAFYSIIITGLITLIFGANAIGHPAQTGIAGVIIKIASKLNPLVLLPLLTFTNVSVRK FFFCAAVVIFYGYMQQSLQGIYISVLCAGAFFLLKVRLNGAIFILMLLSPIIFLGPLLDIITHLYTIRNE IRGVSFSVEEIFSLALGRISTTSSLIYTISNSFNTTGVSDYFVFGIVIERLIGVHILDTVSPSQVFNTYI LGANADYSIFMGLAGFLYFIKDFTCSVYCKCCVFDLGTDSYILGANADYSIFMGLAGFFVFLLKTSPAVF IVNAACLILVLILIYLLIPVNNVKYRTSVFFLIMYLPFLSFDIWEISIVFQTIIIWRVFLLLSKISFGLK



CommentFrom [2]

GT name Position in
gene sequence
Linkage number Donor Acceptor Similar to BLAST Comments
WfaA 1 AAZ20760 [2]
WfaB 2 2 aDGlcNAc(1-> ->2)bDMan O152 WfgE (ECODAB)
O56 WfaQ (ECODAB)
O29 WffY (ECODAB)
O24 WfaO (ECODAB)
AAZ20762 [2]
WfaC 3 4 bDGlc(1-> ->3)aL6dTal O55:H6 WbgP(ECODAB)
O55:H7 WbgP(ECODAB)
O112ab WfeF (ECODAB)
O24 WbdN (ECODAB)
O113 WbnA (ECODAB)
O143 WfdV (ECODAB)
AAZ20763 [2]
WfaE 4 AAZ20765 [2]

References [1] Carbohydr. Res. 278 (1995) 155-165 [PubMed 8536267]
[2] J. Microbiol. 45 (1) (2007)69-74 [PubMed 17342059]
Edit this entry
 
Sat Aug 23 11:25:22 CEST 2014