Main
Components
List
Summary
Search

SerogroupO28 
SerotypeO28ac:H- 
Strain 
ECODAB#8

Structure
->2)(R)Gro-1-P(O->4)bDGlcNAc(1->3)bDGalf2Ac(1->3)aDGlcNAc(1-> 
CarbBank
LinucsID
Non-sugar componentsacetate, glycerol, phosphate 
CommentsStructure [1] 

Identical to 
Cross-reacts with 

1H-NMR
4.69 3.72 3.76 3.97 3.51 3.78 3.89 2.08
5.21 4.88 4.35 4.26 3.92 3.64 3.68
5.01 4.06 3.86 3.47 3.84 3.80 3.86 2.05
4.02 4.06 3.89 3.76 3.76
 
ConditionsSolvent: D2O; Temp.: 50C
Referenceacetone=2.225ppm
Comment1H-NMR [1], pD=6

13C-NMR
101.1 56.1 73.6(JCP=2.4) 75.0(JCP=6.2)
75.9(JCP=5.5) 61.3 23.2 175.3
106.7 82.4 83.3 83.2 71.0 63.8 21.0 173.3
97.8 53.9 77.9 69.1 73.1 61.4 23.0 174.8
65.2(JCP=5.8) 78.1(JCP=7.4) 62.1
 
ConditionsSolvent: D2O; Temp.: 50C
Referenceacetone=31.00ppm
Comment13C-NMR [1], pD=6

wzx (flippase)
TrEMBL entry A4K7Z5
Sequence

MSLILTDFGFNLSSTEYIARNCQSKDKINKHIGAVFQIKILLIFLCVIFLYFLVNDQLQQFKIEFFFYSC IAIIGQTFQSLWFFQGVEKMKRITLFLTISKFSYVILTFVIVKKPEQGRFVILAYALSQVIGALLSQYYM RKEGYKYTPANLSSMLGVLRTSALFFWSRLAVSTYTTASTLVVGAAGHVQAGYYAASEQLYKAGQNITTP VSQALYPYMTRAKNWALFFKMMSILTVVMITASLTAIWLSQWLIALIFGPEYIVSQNVFIVFMLALIVTF VSTNFGYPVFSALGKVKVANYTVIFGALTHVVILGVLFCLGEISAYNVVRAVLFTEIVILILRMFFFVKL YRREVK



wzy (polymerase)
TrEMBL entry A4K7Z7
Sequence

MKQARIKPFSYLSLSFFVLFLIFLNISAVSFDEYLTDLQYSYAYVLFAISLVAVYYAQGESYTSLGFLFN TCLFLFIGGRFIATTFGIDSESVFTLDFMTTYIPTSDEKLEIYTRVVSFQIFLNLGYLFLRKEDSLLNLN KNDNSLPGRLLFLIVIVLFLLCLVEQYSMLSKAMSEGYLARYGDQAESYDAGAAFKYTLLFVFTGLLFAT CKKKYIIINFMIYMTLATIIILIGARGAFVSTILMGVWLYGLNKKISLKKLSIIFLSLAGILLIIMNFSA RGNYYSNELIDSLLRFLYDQGNTLAVVGYVRTITDYPVFAYISTFLPGSSFFASMFHGGSDLNSYMLSFP AYANYVANPNMYFAGYGLGWSIISSVEMFSADILFIFCIFSVLIGMFLKFANEQAKRNSFWFGAVACLCA KILFTARADIKTIIPLFMYYAIMYLIISTAMRILRQRYG



CommentDeposited as DQ462205 in Genbank [2] (Unpublished).

GT name Position in
gene sequence
Linkage number Donor Acceptor Similar to BLAST Comments
WbeS 1 3 (R)Gro-1-P(O-> ->4)bDGlcNAc ABF01009 glycerol phosphotransferase [2]
WbeX 2 2 bDGlcNAc(1-> ->3)bDGalf O42 WbeX (ECODAB)
O112ab WfeF (ECODAB)
ABF01011 [2]
WbeY 3 1 bDGalf(1-> ->3)aDGlcNAc O42 WbeY (ECODAB)
167 WfdK (ECODAB)
167 WfdJ (ECODAB)
ABF01012 [2]

References [1] Carbohydr Res. (1996) 127-39 [PubMed 8864227]
[2] Sequencing of the Escherichia coli O2, O28ac, O63 and O42 O antigen clusters and detection of pathogenic strains by multiplex PCR assays targeting virulence genes in the respective O-antigen gene clusters. Submitted (10-DEC-2008).
Edit this entry
 
Thu Apr 24 20:41:26 CEST 2014