Main
Components
List
Summary
Search

SerogroupO111 
Serotype 
Strain 
ECODAB#88

Structure
aCol(1->6)
        |
 ->4)aDGlc(1->4)aDGal(1->3)bDGlcNAc(1->
        |
aCol(1->3) 
CarbBank
LinucsID 4786
Non-sugar components 
CommentsStructure [1]. Very poor NMR data - caution 

Identical toSalmonella adelaide, group O [2] - but see also [3] 
Cross-reacts with 

1H-NMR
 
ConditionsSolvent: not stated; Temp.:
Referencenot stated=ppm
Comment

13C-NMR
102 101 82 79 78 77 75 74.5 73 72 70.5 69
68 65 63 61.5 56 35 34.5 24 17.4 17.1
 
ConditionsSolvent: not stated; Temp.:
Referencenot stated=ppm
Comment13C-NMR [4]. Manually extracted from picture. Shifts +/-=0.5 ppm! Some signals very broad, some arise from several overlapping resonance. A signal at 31.0 ppm is possibly acetone.

wzx (flippase)
TrEMBL entry Q46722
Sequence

MVLTVKKILAFGYSKVLPPVIEQFVNPICIFIITPLILNHLGKQSYGNWILLITIVSFSQ LICGGCSAWIAKIIAEQRILSDLSKKNALRQISYNFSIVIIAFAVLISFLILSICFFDVA RNNSSFLFAIIICGFFQEVDNLFSGALKGFEKFNVSCFFEVITRVLWASIVIYGIYGNAL LYFTCLAFTIKGMLKYILVCLNITGCFINPNFNRVGIVNLLNESKWMFLQLTGGVSLSLF DRLVIPLILSVSKLASYVPCLQLAQLMFTLSASANQILLPMFARMKASNTFPSNCFFKIL LVSLISVLPCLALFFFGRDILSIWINPTFATENYKLMQILAISYILLSMMTSFHFLLLGI GKSKLVANLNLVAGLALAASTLIAAHYGLYAISMVKIIYPAFQFYYLYVAFVYFNRAKNV



wzy (polymerase)
TrEMBL entry Q9S521
Sequence

MSIDLLFSITEIAIVFSCTIYIFTQCLLMRRIYLDKSILILLCLLFFLVIIQLPELNVNG LVDSLKLSLPLLMVFIAFQKPKLCLWVIIALLFLNSAFNFLYLKTFDKFSSFPFTFFILL FYLFRLGIGNLPVYKNKKFYALIFLFILIDIMQSLLINYRGQILYSVICILILVFKVNLR KKIPYFFLMLPVLYVIIMAYIGFNYFNKGVTFFEPTASNIERTGMIYYLVSQLGDYIFHG MGTLNFLNNGGQYKTLYGLPSLIPNDPHDFLLRFFISIGVIGALVYHSIFFVFFRRISFL LYERNAPFIVVSCLLLLQVVLIYTLNPFDAFNRLICGLTVGVVYGFAKIR



CommentFrom O111 strain Stoke W [5]

GT name Position in
gene sequence
Linkage number Donor Acceptor Similar to BLAST Comments
WbdH 1 1 aDGal(1-> ->3)bDGlcNAc O121 WbqI (ECODAB)
O138 WfaH (ECODAB)
O52 Orf16 (ECODAB)
O113 WbnE (ECODAB)
5678715 [5], [6]
WbdL 2 2 aDGlc(1-> ->4)aDGal O168 WfeY (ECODAB)
O159 WfgS (ECODAB)
O168 WfeV (ECODAB)
AAD46731 [5], [6]
WbdM 3 3, 4 aCol(1-> ->3)aDGlc
->6)aDGlc
O121 WbqH (ECODAB)
O87 WfgO (ECODAB)
O113 WbnE (ECODAB)
AAD46732 [5], [6]

References [1] K. Eklund, P.J. Garegg, L. Kenne, A.A. Lindberg, B. Lindberg (1978). Structural studies on the Escherichia coli O111 lipopolysaccharide. Abstr 493, In Abstracts of the IXth International Symposium of Carbohydrate Chemistry, London, 1978
[2] Carbohydr. Res. 111 (1983) 289-296 [PubMed 6339053]
[3] J. Biol. Chem. 242 (1967) 4125-4133 [PubMed 4863044]
[4] Infect Immun. 63 (1995) 2805-2810 [PubMed 7542631]
[5] J. Clin. Microbiol. 36 (1998) 3182-3187 [PubMed 9774562]
[6] Appl Environ Microbiol. 74(4)(2008) [PubMed 18156323]
Edit this entry
 
Fri Aug 1 17:54:18 CEST 2014